PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022229m
Common NameEUTSA_v10022229mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 201aa    MW: 22859.4 Da    PI: 8.6127
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022229mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.21.8e-172269350
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     +e +  r +tfskR+ gi+KK +E+ +LCd+e+a ++fs+ gk y+++
  Thhalv10022229m 22 VETYADRMITFSKRKSGIFKKMNEIITLCDVEAAFMVFSQAGKPYTFA 69
                     677889*****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.3431272IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-221271IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-221386IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-161434IPR002100Transcription factor, MADS-box
Gene3DG3DSA:2.40.128.206.8E-519128IPR012674Calycin
PfamPF003195.1E-192368IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-163449IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-164970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MSMKHTKGKQ TKGKQKIEMK VVETYADRMI TFSKRKSGIF KKMNEIITLC DVEAAFMVFS  60
QAGKPYTFAH PSMEKVVGLL RHEPSSKDVT NTGALVEAYK RQRIEELMKK YVDLVEELEM  120
EKENVKNLKG SRFEKKLDKM WWNIPSEGLS MEELKQRHQA FVELHDSLCA INIQRLGKDC  180
DGSSSGHVER GHCGEGEAEA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408223.11e-148hypothetical protein EUTSA_v10022229mg
TrEMBLV4NSM71e-148V4NSM7_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30003032e-79(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04100.11e-72AGAMOUS-like 57